ALDOC antibody (C-Term)

Catalog No. ABIN631176

Product Details anti-ALDOC Antibody

Target: ALDOC (Aldolase C, Fructose-Bisphosphate (ALDOC))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALDOC antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ALDOC antibody was raised against the C terminal of ALDOC

Purification: Affinity purified

Immunogen: ALDOC antibody was raised using the C terminal of ALDOC corresponding to a region with amino acids CPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALDOC Blocking Peptide, catalog no. 33R-1767, is also available for use as a blocking control in assays to test for specificity of this ALDOC antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDOC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALDOC

Target: ALDOC (Aldolase C, Fructose-Bisphosphate (ALDOC))

Alternative Name: ALDOC (ALDOC Products)

Synonyms: ALDC antibody, MGC69434 antibody, ALDOC antibody, aldoc antibody, AI847350 antibody, AU040929 antibody, Aldo3 antibody, Scrg2 antibody, ALDCAA antibody, F16dip7 antibody, RATALDCAA antibody, aldocl antibody, wu:fj56h04 antibody, zgc:112357 antibody, QccE-21970 antibody, aldolase, fructose-bisphosphate C antibody, aldolase, fructose-bisphosphate C L homeolog antibody, aldolase C, fructose-bisphosphate, b antibody, aldolase C, fructose-bisphosphate antibody, aldolase A, fructose-bisphosphate antibody, aldolase C, fructose-bisphosphate, a antibody, Fructose-bisphosphate aldolase C antibody, ALDOC antibody, aldoc.L antibody, aldoc antibody, aldocb antibody, Aldoc antibody, ALDOA antibody, aldoca antibody

Background: ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.

Molecular Weight: 39 kDa (MW of target protein)