IMPA2 antibody (Middle Region)
-
- Target See all IMPA2 Antibodies
- IMPA2 (Inositol(myo)-1(or 4)-Monophosphatase 2 (IMPA2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IMPA2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IMPA2 antibody was raised against the middle region of IMPA2
- Purification
- Affinity purified
- Immunogen
- IMPA2 antibody was raised using the middle region of IMPA2 corresponding to a region with amino acids RGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLH
- Top Product
- Discover our top product IMPA2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IMPA2 Blocking Peptide, catalog no. 33R-7934, is also available for use as a blocking control in assays to test for specificity of this IMPA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IMPA2 (Inositol(myo)-1(or 4)-Monophosphatase 2 (IMPA2))
- Alternative Name
- IMPA2 (IMPA2 Products)
- Synonyms
- zgc:110201 antibody, 2210415D20Rik antibody, AI326924 antibody, AW259601 antibody, inositol monophosphatase 2 antibody, inositol(myo)-1(or 4)-monophosphatase 2 antibody, inositol (myo)-1(or 4)-monophosphatase 2 antibody, IMPA2 antibody, impa2 antibody, MGYG_08537 antibody, Impa2 antibody
- Background
- IMPA2 belongs to the inositol monophosphatase family. The present study suggests that a promoter haplotype of IMPA2 possibly contributes to risk for bipolar disorder by elevating IMPA2 levels in the brain, albeit the genetic effect varies among populations.
- Molecular Weight
- 32 kDa (MW of target protein)
-