GLUD1 antibody (N-Term)

Catalog No. ABIN631170

Product Details anti-GLUD1 Antibody

Target: GLUD1 (Glutamate Dehydrogenase 1 (GLUD1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLUD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLUD1 antibody was raised against the N terminal of GLUD1

Purification: Affinity purified

Immunogen: GLUD1 antibody was raised using the N terminal of GLUD1 corresponding to a region with amino acids AKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGER

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLUD1 Blocking Peptide, catalog no. 33R-1287, is also available for use as a blocking control in assays to test for specificity of this GLUD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLUD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLUD1

Target: GLUD1 (Glutamate Dehydrogenase 1 (GLUD1))

Alternative Name: GLUD1 (GLUD1 Products)

Background: L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate. Glutamate, the main substrate of GLUD, is present in brain in concentrations higher than in other organs. In nervous tissue, GLUD appears to function in both the synthesis and the catabolism of glutamate and perhaps in ammonia detoxification.

Molecular Weight: 56 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Warburg Effect