SULT6B1 antibody (C-Term)
-
- Target See all SULT6B1 Antibodies
- SULT6B1 (Sulfotransferase Family, Cytosolic, 6B, Member 1 (SULT6B1))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SULT6B1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SULT6 B1 antibody was raised against the C terminal of SULT6 1
- Purification
- Affinity purified
- Immunogen
- SULT6 B1 antibody was raised using the C terminal of SULT6 1 corresponding to a region with amino acids FLGFFLTGEQIQTISVQSTFQAMRAKSQDTHGAVGPFLFRKGEVGDWKNL
- Top Product
- Discover our top product SULT6B1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SULT6B1 Blocking Peptide, catalog no. 33R-2961, is also available for use as a blocking control in assays to test for specificity of this SULT6B1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SULT6B1 (Sulfotransferase Family, Cytosolic, 6B, Member 1 (SULT6B1))
- Alternative Name
- SULT6B1 (SULT6B1 Products)
- Background
- SULT6B1 belongs to the sulfotransferase 1 family. SULT6B1 may catalyze the sulfate conjugation of many drugs, xenobiotic compounds, hormones, and neurotransmitters.
- Molecular Weight
- 30 kDa (MW of target protein)
-