GCHFR antibody (N-Term)

Catalog No. ABIN631166

Product Details anti-GCHFR Antibody

Target: GCHFR (GTP Cyclohydrolase I Feedback Regulator (GCHFR))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GCHFR antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GCHFR antibody was raised against the N terminal of GCHFR

Purification: Affinity purified

Immunogen: GCHFR antibody was raised using the N terminal of GCHFR corresponding to a region with amino acids MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GCHFR Blocking Peptide, catalog no. 33R-6313, is also available for use as a blocking control in assays to test for specificity of this GCHFR antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCHFR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GCHFR

Target: GCHFR (GTP Cyclohydrolase I Feedback Regulator (GCHFR))

Alternative Name: GCHFR (GCHFR Products)

Synonyms: GFRP antibody, HsT16933 antibody, P35 antibody, 2010323F13Rik antibody, GTP cyclohydrolase I feedback regulator antibody, GCHFR antibody, Gchfr antibody

Background: GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide.

Molecular Weight: 10 kDa (MW of target protein)