GCHFR antibody (N-Term)
-
- Target See all GCHFR Antibodies
- GCHFR (GTP Cyclohydrolase I Feedback Regulator (GCHFR))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GCHFR antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GCHFR antibody was raised against the N terminal of GCHFR
- Purification
- Affinity purified
- Immunogen
- GCHFR antibody was raised using the N terminal of GCHFR corresponding to a region with amino acids MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD
- Top Product
- Discover our top product GCHFR Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GCHFR Blocking Peptide, catalog no. 33R-6313, is also available for use as a blocking control in assays to test for specificity of this GCHFR antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCHFR antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GCHFR (GTP Cyclohydrolase I Feedback Regulator (GCHFR))
- Alternative Name
- GCHFR (GCHFR Products)
- Background
- GTP cyclohydrolase I feedback regulatory protein binds to and mediates tetrahydrobiopterin inhibition of GTP cyclohydrolase I. The regulatory protein, GCHFR, consists of a homodimer. It is postulated that GCHFR may play a role in regulating phenylalanine metabolism in the liver and in the production of biogenic amine neurotransmitters and nitric oxide.
- Molecular Weight
- 10 kDa (MW of target protein)
-