GAMT antibody (N-Term)

Catalog No. ABIN631157

Product Details anti-GAMT Antibody

Target: GAMT (Guanidinoacetate N-Methyltransferase (GAMT))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GAMT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GAMT antibody was raised against the N terminal of GAMT

Purification: Affinity purified

Immunogen: GAMT antibody was raised using the N terminal of GAMT corresponding to a region with amino acids MSAPSATPIFAPGENCSPAWGAAPAAYDAADTHLRILGKPVMERWETPYM

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GAMT Blocking Peptide, catalog no. 33R-6399, is also available for use as a blocking control in assays to test for specificity of this GAMT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAMT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GAMT

Target: GAMT (Guanidinoacetate N-Methyltransferase (GAMT))

Alternative Name: GAMT (GAMT Products)

Synonyms: gamt antibody, zgc:123136 antibody, CCDS2 antibody, PIG2 antibody, TP53I2 antibody, AA571402 antibody, Spintz1 antibody, MGC75698 antibody, GAMT antibody, GMT antibody, guanidinoacetate N-methyltransferase L homeolog antibody, guanidinoacetate N-methyltransferase S homeolog antibody, guanidinoacetate N-methyltransferase antibody, guanidinoacetate methyltransferase antibody, gamt.L antibody, gamt.S antibody, gamt antibody, GAMT antibody, Gamt antibody

Background: GAMT is a methyltransferase that converts guanidoacetate to creatine, using S-adenosylmethionine as the methyl donor. Defects in its gene have been implicated in neurologic syndromes and muscular hypotonia, probably due to creatine deficiency and accumulation of guanidinoacetate in the brain of affected individuals.

Molecular Weight: 26 kDa (MW of target protein)