PNPO antibody (N-Term)

Catalog No. ABIN631149

Product Details anti-PNPO Antibody

Target: PNPO (Pyridoxamine 5'-Phosphate Oxidase (PNPO))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PNPO antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PNPO antibody was raised against the N terminal of PNPO

Purification: Affinity purified

Immunogen: PNPO antibody was raised using the N terminal of PNPO corresponding to a region with amino acids PMRKSYRGDREAFEETHLTSLDPVKQFAAWFEEAVQCPDIGEANAMCLAT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PNPO Blocking Peptide, catalog no. 33R-7225, is also available for use as a blocking control in assays to test for specificity of this PNPO antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPO antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PNPO

Target: PNPO (Pyridoxamine 5'-Phosphate Oxidase (PNPO))

Alternative Name: PNPO (PNPO Products)

Background: PNPO catalyzes the terminal, rate-limiting step in the synthesis of pyridoxal 5'-phosphate, also known as vitamin B6. Vitamin B6 is a required co-factor for enzymes involved in both homocysteine metabolism and synthesis of neurotransmitters such as catecholamine.

Molecular Weight: 29 kDa (MW of target protein)