OGFOD1 antibody (Middle Region)

Catalog No. ABIN631145

Product Details anti-OGFOD1 Antibody

Target: OGFOD1 (2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 1 (OGFOD1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OGFOD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OGFOD1 antibody was raised against the middle region of OGFOD1

Purification: Affinity purified

Immunogen: OGFOD1 antibody was raised using the middle region of OGFOD1 corresponding to a region with amino acids GCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRDRETLKFVKHI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OGFOD1 Blocking Peptide, catalog no. 33R-3184, is also available for use as a blocking control in assays to test for specificity of this OGFOD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OGFOD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OGFOD1

Target: OGFOD1 (2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 1 (OGFOD1))

Alternative Name: OGFOD1 (OGFOD1 Products)

Synonyms: tpa1 antibody, MGC145343 antibody, D63 antibody, wu:fc33b08 antibody, zgc:66379 antibody, TPA1 antibody, 4930415J21Rik antibody, AA387199 antibody, AA939912 antibody, AW061076 antibody, mKIAA1612 antibody, RGD1308848 antibody, 2-oxoglutarate and iron dependent oxygenase domain containing 1 antibody, 2-oxoglutarate and iron-dependent oxygenase domain containing 1 antibody, 2-oxoglutarate and iron dependent oxygenase domain containing 1 L homeolog antibody, OGFOD1 antibody, ogfod1 antibody, ogfod1.L antibody, Ogfod1 antibody

Background: The function of OGFOD1 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 63 kDa (MW of target protein)