EGLN3 antibody

Catalog No. ABIN631137

Product Details anti-EGLN3 Antibody

Target: EGLN3 (Egl-9 Family Hypoxia Inducible Factor 3 (EGLN3))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EGLN3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: EGLN3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EGLN3 Blocking Peptide, catalog no. 33R-3129, is also available for use as a blocking control in assays to test for specificity of this EGLN3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EGLN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EGLN3

Target: EGLN3 (Egl-9 Family Hypoxia Inducible Factor 3 (EGLN3))

Alternative Name: EGLN3 (EGLN3 Products)

Synonyms: zgc:77019 antibody, wu:fj78a08 antibody, EGLN3 antibody, phd3 antibody, PHD-3 antibody, PHD3 antibody, SM-20 antibody, 2610021G09Rik antibody, AI505553 antibody, AI648162 antibody, Hif-p4h-3 antibody, Phd3 antibody, HIFP4H3 antibody, HIFPH3 antibody, egl-9 family hypoxia-inducible factor 3 antibody, egl-9 family hypoxia inducible factor 3 antibody, egl-9 family hypoxia-inducible factor 3 L homeolog antibody, egln3 antibody, EGLN3 antibody, egln3.L antibody, Egln3 antibody

Background: EGLN3 catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. It hydroxylates HIF-1 alpha at 'Pro-564', and HIF-2 alpha. EGLN3 functions as a cellular oxygen sensor and, under normoxic conditions, targets HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. It may play a role in cell growth regulation in muscle cells and in apoptosis in neuronal tissue. EGLN3 promotes cell death through a caspase-dependent mechanism.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity