TGS1 antibody
-
- Target See all TGS1 Antibodies
- TGS1 (Trimethylguanosine Synthase 1 (TGS1))
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TGS1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- TGS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDENPASDFDDSGSLLGFKYGSGQKYGGIPNFSHRQVRYLEKNVKLKSKY
- Top Product
- Discover our top product TGS1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TGS1 Blocking Peptide, catalog no. 33R-3910, is also available for use as a blocking control in assays to test for specificity of this TGS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TGS1 (Trimethylguanosine Synthase 1 (TGS1))
- Alternative Name
- TGS1 (TGS1 Products)
- Synonyms
- NCOA6IP antibody, PIMT antibody, PIPMT antibody, D4Ertd800e antibody, Ncoa6ip antibody, Pimt antibody, trimethylguanosine synthase 1 antibody, trimethylguanosine synthase 1 L homeolog antibody, TGS1 antibody, Tgs1 antibody, tgs1.L antibody
- Background
- TGS1 catalyzes the methylation step(s) for the conversion of the 7-monomethylguanosine (m7G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure. TGS1 plays a role in transcriptional regulation.
- Molecular Weight
- 96 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, Regulation of Lipid Metabolism by PPARalpha, Ribonucleoprotein Complex Subunit Organization
-