IER5 antibody (N-Term)

Catalog No. ABIN631134

Product Details anti-IER5 Antibody

Target: IER5 (Immediate Early Response 5 (IER5))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This IER5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: IER5 antibody was raised against the N terminal of IER5

Purification: Affinity purified

Immunogen: IER5 antibody was raised using the N terminal of IER5 corresponding to a region with amino acids MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

IER5 Blocking Peptide, catalog no. 33R-5913, is also available for use as a blocking control in assays to test for specificity of this IER5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IER5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for IER5

Target: IER5 (Immediate Early Response 5 (IER5))

Alternative Name: IER5 (IER5 Products)

Synonyms: si:dz129i22.1 antibody, wu:fa99a02 antibody, wu:fb04b03 antibody, wu:fb11f08 antibody, zgc:136422 antibody, sbbi48 antibody, MGC83180 antibody, IER5 antibody, SBBI48 antibody, immediate early response 5 antibody, immediate early response 5 L homeolog antibody, ier5 antibody, ier5.L antibody, IER5 antibody, Ier5 antibody

Background: This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals.

Molecular Weight: 34 kDa (MW of target protein)