Arrestin 3 antibody (Middle Region)

Catalog No. ABIN631132

Product Details anti-Arrestin 3 Antibody

Target: Arrestin 3 (ARRB2) (Arrestin, beta 2 (ARRB2))

Binding Specificity: Middle Region

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Arrestin 3 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: Arrestin B2 antibody was raised against the middle region of ARRB2

Purification: Affinity purified

Immunogen: Arrestin B2 antibody was raised using the middle region of ARRB2 corresponding to a region with amino acids RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Arrestin B2 Blocking Peptide, catalog no. 33R-8056, is also available for use as a blocking control in assays to test for specificity of this Arrestin B2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARRB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Arrestin 3

Target: Arrestin 3 (ARRB2) (Arrestin, beta 2 (ARRB2))

Abstract: ARRB2 Products

Synonyms: ARRB2 antibody, arb2 antibody, arr2 antibody, arrestin antibody, barr2 antibody, betaarr2 antibody, ARB2 antibody, ARR2 antibody, BARR2 antibody, BARRES antibody, AI326910 antibody, AW122872 antibody, arrb2 antibody, zgc:64007 antibody, arrestin beta 2 antibody, arrestin, beta 2 antibody, arrestin beta 2 L homeolog antibody, arrestin, beta 2b antibody, ARRB2 antibody, arrb2 antibody, Arrb2 antibody, arrb2.L antibody, arrb2b antibody

Background: Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. ARRB2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Intracellular Steroid Hormone Receptor Signaling Pathway, Regulation of Intracellular Steroid Hormone Receptor Signaling, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Regulation of Leukocyte Mediated Immunity, Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling, CXCR4-mediated Signaling Events, Phototransduction, Thromboxane A2 Receptor Signaling