PYGB antibody (N-Term)

Catalog No. ABIN631127

Product Details anti-PYGB Antibody

Target: PYGB (GPBB) (phosphorylase, Glycogen, Brain (GPBB))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PYGB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PYGB antibody was raised against the N terminal of PYGB

Purification: Affinity purified

Immunogen: PYGB antibody was raised using the N terminal of PYGB corresponding to a region with amino acids QQHYYERDPKRIYYLSLEFYMGRTLQNTMVNLGLQNACDEAIYQLGLDLE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PYGB Blocking Peptide, catalog no. 33R-7693, is also available for use as a blocking control in assays to test for specificity of this PYGB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYGB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PYGB

Target: PYGB (GPBB) (phosphorylase, Glycogen, Brain (GPBB))

Alternative Name: PYGB (GPBB Products)

Synonyms: GPBB antibody, GLYPHOA antibody, glycogen phosphorylase B antibody, phosphorylase, glycogen; brain antibody, brain glycogen phosphorylase antibody, phosphorylase, glycogen; brain S homeolog antibody, PYGB antibody, pygb antibody, Pygb antibody, pygb.S antibody

Background: PYGB is a glycogen phosphorylase found predominantly in the brain. It forms homodimers which can associate into homotetramers, the enzymatically active form of glycogen phosphorylase. The activity of this enzyme is positively regulated by AMP and negatively regulated by ATP, ADP, and glucose-6-phosphate. This enzyme catalyzes the rate-determining step in glycogen degradation.

Molecular Weight: 97 kDa (MW of target protein)

Pathways: Cellular Glucan Metabolic Process