BRWD1 antibody (N-Term)

Catalog No. ABIN631121

Product Details anti-BRWD1 Antibody

Target: BRWD1 (Bromodomain and WD Repeat Domain Containing 1 (BRWD1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BRWD1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BRWD1 antibody was raised against the N terminal of BRWD1

Purification: Affinity purified

Immunogen: BRWD1 antibody was raised using the N terminal of BRWD1 corresponding to a region with amino acids MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAAQVLVQELEQYQLLPK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BRWD1 Blocking Peptide, catalog no. 33R-5643, is also available for use as a blocking control in assays to test for specificity of this BRWD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BRWD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BRWD1

Target: BRWD1 (Bromodomain and WD Repeat Domain Containing 1 (BRWD1))

Alternative Name: BRWD1 (BRWD1 Products)

Synonyms: WDR9 antibody, BRWD1 antibody, C21orf107 antibody, N143 antibody, 5330419I02Rik antibody, D530019K20Rik antibody, G1-403-16 antibody, Wdr9 antibody, repro5 antibody, bromodomain and WD repeat domain containing 1 antibody, bromodomain and WD repeat-containing protein 1 antibody, BRWD1 antibody, LOC100226455 antibody, brwd1 antibody, Brwd1 antibody

Background: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com

Molecular Weight: 13 kDa (MW of target protein)