TUFM antibody (Middle Region)
-
- Target See all TUFM (Tufm) Antibodies
- TUFM (Tufm) (Tu Translation Elongation Factor, Mitochondrial (Tufm))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TUFM antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TUFM antibody was raised against the middle region of TUFM
- Purification
- Affinity purified
- Immunogen
- TUFM antibody was raised using the middle region of TUFM corresponding to a region with amino acids PEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAM
- Top Product
- Discover our top product Tufm Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TUFM Blocking Peptide, catalog no. 33R-7046, is also available for use as a blocking control in assays to test for specificity of this TUFM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TUFM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TUFM (Tufm) (Tu Translation Elongation Factor, Mitochondrial (Tufm))
- Alternative Name
- TUFM (Tufm Products)
- Synonyms
- TUFM antibody, D250 antibody, fi06f04 antibody, wu:fi06f04 antibody, zgc:110766 antibody, COXPD4 antibody, EF-TuMT antibody, EFTU antibody, P43 antibody, 2300002G02Rik antibody, C76308 antibody, C76389 antibody, Tu translation elongation factor, mitochondrial antibody, TUFM antibody, tufm antibody, Tufm antibody
- Background
- TUFM is a protein which participates in protein translation in mitochondria. Mutations in this gene have been associated with combined oxidative phosphorylation deficiency resulting in lactic acidosis and fatal encephalopathy.
- Molecular Weight
- 50 kDa (MW of target protein)
-