NR1I3 antibody (Middle Region)
-
- Target See all NR1I3 Antibodies
- NR1I3 (Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NR1I3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NR1 I3 antibody was raised against the middle region of NR1 3
- Purification
- Affinity purified
- Immunogen
- NR1 I3 antibody was raised using the middle region of NR1 3 corresponding to a region with amino acids PVFRSLPIEDQISLLKGAAVEICHIVLNTTFCLQTQNFLCGPLRYTIEDG
- Top Product
- Discover our top product NR1I3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NR1I3 Blocking Peptide, catalog no. 33R-7407, is also available for use as a blocking control in assays to test for specificity of this NR1I3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NR1I3 (Nuclear Receptor Subfamily 1, Group I, Member 3 (NR1I3))
- Alternative Name
- NR1I3 (NR1I3 Products)
- Synonyms
- AA209988 antibody, AI551208 antibody, CAR antibody, CAR-beta antibody, Care2 antibody, ESTM32 antibody, MB67 antibody, CAR1 antibody, CXR antibody, nuclear receptor subfamily 1 group I member 3 antibody, nuclear receptor subfamily 1, group I, member 3 antibody, NR1I3 antibody, Nr1i3 antibody
- Background
- NR1I3 mediates the induction of transcription of cytochrome P450 (CYP) genes by phenobarbital (PB) and PB-type inducers. NR1I3 activation induces hepatic expression of detoxification enzymes and transporters and increases liver size. NR1I3 can also regulate both liver homeostasis and tumorigenesis in response to xenobiotic stresses.
- Molecular Weight
- 35 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway
-