EIF2C3 antibody (N-Term)

Catalog No. ABIN631112

Product Details anti-EIF2C3 Antibody

Target: EIF2C3 (Eukaryotic Translation Initiation Factor 2C3 (EIF2C3))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EIF2C3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: EIF2 C3 antibody was raised against the N terminal of EIF2 3

Purification: Affinity purified

Immunogen: EIF2 C3 antibody was raised using the N terminal of EIF2 3 corresponding to a region with amino acids MCEVLDIHNIDEQPRPLTDSHRVKFTKEIKGLKVEVTHCGTMRRKYRVCN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EIF2C3 Blocking Peptide, catalog no. 33R-5810, is also available for use as a blocking control in assays to test for specificity of this EIF2C3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EIF0 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EIF2C3

Target: EIF2C3 (Eukaryotic Translation Initiation Factor 2C3 (EIF2C3))

Alternative Name: EIF2C3 (EIF2C3 Products)

Synonyms: EIF2C3 antibody, Eif2c3 antibody, Argonaute3 antibody, ago3 antibody, eif2c3 antibody, eif2c3b antibody, si:dkey-3n22.3 antibody, AW048688 antibody, C130014L07Rik antibody, ARGONAUTE 3 antibody, T19E23.8 antibody, T19E23_8 antibody, argonaute 3, RISC catalytic component antibody, argonaute RISC catalytic component 3b antibody, argonaute RISC catalytic subunit 3 antibody, argonaute RISC catalytic component 3 antibody, ARGONAUTE 3 antibody, AGO3 antibody, Ago3 antibody, ago3b antibody

Background: EIF2C3 is a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, contains a PAZ domain and a PIWI domain, and may play a role in short-interfering-RNA-mediated gene silencing.

Molecular Weight: 69 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, Regulatory RNA Pathways, EGFR Signaling Pathway, Neurotrophin Signaling Pathway