PIWIL1 antibody
-
- Target See all PIWIL1 Antibodies
- PIWIL1 (Piwi-Like 1 (PIWIL1))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PIWIL1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PIWIL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY
- Top Product
- Discover our top product PIWIL1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PIWIL1 Blocking Peptide, catalog no. 33R-5494, is also available for use as a blocking control in assays to test for specificity of this PIWIL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PIWIL1 (Piwi-Like 1 (PIWIL1))
- Alternative Name
- PIWIL1 (PIWIL1 Products)
- Synonyms
- ziwi antibody, PIWI antibody, HIWI antibody, MIWI antibody, piwi like RNA-mediated gene silencing 1 antibody, PIWI-like protein 1 antibody, putative PIWI-like protein 1 antibody, putative argonaut-like protein antibody, piwi-like RNA-mediated gene silencing 1 antibody, PIWIL1 antibody, Tb10.70.5520 antibody, LINJ_21_0470 antibody, LBRM_21_0470 antibody, piwil1 antibody, Piwil1 antibody
- Background
- PIWIL1 is a member of the PIWI subfamily of Argonaute proteins, evolutionarily conserved proteins containing both PAZ and Piwi motifs that play important roles in stem cell self-renewal, RNA silencing, and translational regulation in diverse organisms. PIWIL1 may play a role as an intrinsic regulator of the self-renewal capacity of germline and hematopoietic stem cells.
- Molecular Weight
- 98 kDa (MW of target protein)
-