RNF207 antibody (N-Term)

Catalog No. ABIN631110

Product Details anti-RNF207 Antibody

Target: RNF207 (RING Finger Protein 207 (RNF207))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RNF207 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RNF207 antibody was raised against the N terminal of RNF207

Purification: Affinity purified

Immunogen: RNF207 antibody was raised using the N terminal of RNF207 corresponding to a region with amino acids CLLDCFHDFCAGCLRGRATDGRLTCPLCQHQTVLKGPSGLPPVDRLLQFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RNF207 Blocking Peptide, catalog no. 33R-1739, is also available for use as a blocking control in assays to test for specificity of this RNF207 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF207 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RNF207

Target: RNF207 (RING Finger Protein 207 (RNF207))

Alternative Name: RNF207 (RNF207 Products)

Synonyms: C1orf188 antibody, D330010C22Rik antibody, Gm143 antibody, ring finger protein 207 antibody, RNF207 antibody, Rnf207 antibody

Background: RNF207 contains 1 B box-type zinc finger and 1 RING-type zinc finger. The function of the RNF207 protein remains unknown.

Molecular Weight: 71 kDa (MW of target protein)