RPS21 antibody (N-Term)

Catalog No. ABIN631108

Product Details anti-RPS21 Antibody

Target: RPS21 (Ribosomal Protein S21 (RPS21))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS21 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPS21 antibody was raised against the N terminal of RPS21

Purification: Affinity purified

Immunogen: RPS21 antibody was raised using the N terminal of RPS21 corresponding to a region with amino acids MQNDAGEFVDLYVPRKCSASNRIIGAKDHASIQMNVAEVDKVTGRFNGQF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS21 Blocking Peptide, catalog no. 33R-6335, is also available for use as a blocking control in assays to test for specificity of this RPS21 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS21

Target: RPS21 (Ribosomal Protein S21 (RPS21))

Alternative Name: RPS21 (RPS21 Products)

Synonyms: CG2986 antibody, Dmel\\CG2986 antibody, M(2)23B antibody, l(2)03575 antibody, l(2)168/14 antibody, l(2)k16814 antibody, oho23 antibody, oho23B antibody, rpS21 antibody, RPS21 antibody, S21 antibody, 1810049N11Rik antibody, 2410030A14Rik antibody, zgc:56642 antibody, zgc:86816 antibody, Ribosomal protein S21 antibody, 40S ribosomal protein S21 antibody, ribosomal protein S21 antibody, ribosomal protein S21 S homeolog antibody, RpS21 antibody, rps21b antibody, rps-21 antibody, RPS21 antibody, Rps21 antibody, rps21 antibody, rps21.S antibody

Background: Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molecular Weight: 9 kDa (MW of target protein)