MTCH2 antibody

Catalog No. ABIN631106

Product Details anti-MTCH2 Antibody

Target: MTCH2 (Mitochondrial Carrier 2 (MTCH2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTCH2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MTCH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTCH2 Blocking Peptide, catalog no. 33R-1082, is also available for use as a blocking control in assays to test for specificity of this MTCH2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTCH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTCH2

Target: MTCH2 (Mitochondrial Carrier 2 (MTCH2))

Alternative Name: MTCH2 (MTCH2 Products)

Synonyms: MIMP antibody, SLC25A50 antibody, Hspc032 antibody, fi20c06 antibody, fj35g12 antibody, wu:fi20c06 antibody, wu:fj35g12 antibody, 2310034D24Rik antibody, 4930539J07Rik antibody, HSPC032 antibody, mitochondrial carrier 2 antibody, mitochondrial carrier 2 L homeolog antibody, mitochondrial carrier homolog 2 antibody, MTCH2 antibody, mtch2.L antibody, Mtch2 antibody, mtch2 antibody

Background: MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.

Molecular Weight: 33 kDa (MW of target protein)