SPATA5 antibody (Middle Region)

Catalog No. ABIN631101

Product Details anti-SPATA5 Antibody

Target: SPATA5 (Spermatogenesis Associated 5 (SPATA5))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPATA5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SPATA5 antibody was raised against the middle region of SPATA5

Purification: Affinity purified

Immunogen: SPATA5 antibody was raised using the middle region of SPATA5 corresponding to a region with amino acids ALLALEEDIQANLIMKRHFTQALSTVTPRIPESLRRFYEDYQEKSGLHTL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPATA5 Blocking Peptide, catalog no. 33R-1347, is also available for use as a blocking control in assays to test for specificity of this SPATA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPATA5

Target: SPATA5 (Spermatogenesis Associated 5 (SPATA5))

Alternative Name: SPATA5 (SPATA5 Products)

Synonyms: AFG2 antibody, SPAF antibody, 2510048F20Rik antibody, C78064 antibody, Spaf antibody, spermatogenesis associated 5 antibody, SPATA5 antibody, Spata5 antibody

Background: SPATA5 may be involved in morphological and functional mitochondrial transformations during spermatogenesis.

Molecular Weight: 98 kDa (MW of target protein)