CHCHD4 antibody (N-Term)

Catalog No. ABIN631099

Product Details anti-CHCHD4 Antibody

Target: CHCHD4 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 4 (CHCHD4))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHCHD4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CHCHD4 antibody was raised against the N terminal of CHCHD4

Purification: Affinity purified

Immunogen: CHCHD4 antibody was raised using the N terminal of CHCHD4 corresponding to a region with amino acids MSYCRQEGKDRIIFVTKEDHETPSSAELVADDPNDPYEEHGLILPNGNIN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHCHD4 Blocking Peptide, catalog no. 33R-6527, is also available for use as a blocking control in assays to test for specificity of this CHCHD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHCHD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHCHD4

Target: CHCHD4 (Coiled-Coil-Helix-Coiled-Coil-Helix Domain Containing 4 (CHCHD4))

Alternative Name: CHCHD4 (CHCHD4 Products)

Synonyms: 2410012P20Rik antibody, 2810014D17Rik antibody, AI838740 antibody, MIA40 antibody, TIMM40 antibody, mia40 antibody, timm40 antibody, chchd4 antibody, chchd4a antibody, fc10g04 antibody, wu:fc10g04 antibody, zgc:100849 antibody, si:dkey-202e22.1 antibody, chchd4b antibody, CaO19.2977 antibody, coiled-coil-helix-coiled-coil-helix domain containing 4 antibody, coiled-coil-helix-coiled-coil-helix domain containing 4 L homeolog antibody, coiled-coil-helix-coiled-coil-helix domain containing 4a antibody, coiled-coil-helix-coiled-coil-helix domain containing 4 S homeolog antibody, Mia40p antibody, Chchd4 antibody, CHCHD4 antibody, chchd4 antibody, chchd4.L antibody, chchd4a antibody, chchd4.S antibody, LOC100361898 antibody, MIA40 antibody

Background: CHCHD4, a component of human mitochondria, belongs to a protein family whose members share 6 highly conserved cysteine residues constituting a -CXC-CX(9)C-CX(9)C- motif in the C terminus.

Molecular Weight: 16 kDa (MW of target protein)