GLYATL2 antibody (Middle Region)

Catalog No. ABIN631098

Product Details anti-GLYATL2 Antibody

Target: GLYATL2 (Glycine-N-Acyltransferase-Like 2 (GLYATL2))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLYATL2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLYATL2 antibody was raised against the middle region of GLYATL2

Purification: Affinity purified

Immunogen: GLYATL2 antibody was raised using the middle region of GLYATL2 corresponding to a region with amino acids LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLYATL2 Blocking Peptide, catalog no. 33R-4843, is also available for use as a blocking control in assays to test for specificity of this GLYATL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLYATL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLYATL2

Target: GLYATL2 (Glycine-N-Acyltransferase-Like 2 (GLYATL2))

Alternative Name: GLYATL2 (GLYATL2 Products)

Synonyms: BXMAS2-10 antibody, GATF-B antibody, glycine-N-acyltransferase like 2 antibody, GLYATL2 antibody

Background: GLYATL2 belongs to the glycine N-acyltransferase family. GLYATL2 is a mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. It can conjugate a multitude of substrates to form a variety of N-acylglycines.

Molecular Weight: 34 kDa (MW of target protein)