GLYATL2 antibody (Middle Region)
-
- Target See all GLYATL2 Antibodies
- GLYATL2 (Glycine-N-Acyltransferase-Like 2 (GLYATL2))
-
Binding Specificity
- Middle Region
- Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GLYATL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GLYATL2 antibody was raised against the middle region of GLYATL2
- Purification
- Affinity purified
- Immunogen
- GLYATL2 antibody was raised using the middle region of GLYATL2 corresponding to a region with amino acids LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK
- Top Product
- Discover our top product GLYATL2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GLYATL2 Blocking Peptide, catalog no. 33R-4843, is also available for use as a blocking control in assays to test for specificity of this GLYATL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLYATL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLYATL2 (Glycine-N-Acyltransferase-Like 2 (GLYATL2))
- Alternative Name
- GLYATL2 (GLYATL2 Products)
- Synonyms
- BXMAS2-10 antibody, GATF-B antibody, glycine-N-acyltransferase like 2 antibody, GLYATL2 antibody
- Background
- GLYATL2 belongs to the glycine N-acyltransferase family. GLYATL2 is a mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. It can conjugate a multitude of substrates to form a variety of N-acylglycines.
- Molecular Weight
- 34 kDa (MW of target protein)
-