PCCA antibody (N-Term)

Catalog No. ABIN631082

Product Details anti-PCCA Antibody

Target: PCCA (Propionyl CoA Carboxylase, alpha Polypeptide (PCCA))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCCA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCCA antibody was raised against the N terminal of PCCA

Purification: Affinity purified

Immunogen: PCCA antibody was raised using the N terminal of PCCA corresponding to a region with amino acids LYYSRQCLMVSRNLGSVGYDPNEKTFDKILVANRGEIACRVIRTCKKMGI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCCA Blocking Peptide, catalog no. 33R-5579, is also available for use as a blocking control in assays to test for specificity of this PCCA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCCA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCCA

Target: PCCA (Propionyl CoA Carboxylase, alpha Polypeptide (PCCA))

Alternative Name: PCCA (PCCA Products)

Background: PCCA is the alpha subunit of the heterodimeric mitochondrial enzyme Propionyl-CoA carboxylase. PCCA is the biotin-binding region of this enzyme. Mutations in either PCCA or PCCB (encoding the beta subunit) lead to an enzyme deficiency resulting in propionic acidemia.

Molecular Weight: 75 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process