DLAT antibody (C-Term)
-
- Target See all DLAT Antibodies
- DLAT (Dihydrolipoyl Transacetylase (DLAT))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, C. elegans
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DLAT antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DLAT antibody was raised against the C terminal of DLAT
- Purification
- Affinity purified
- Immunogen
- DLAT antibody was raised using the C terminal of DLAT corresponding to a region with amino acids DVVSLATKAREGKLQPHEFQGGTFTISNLGMFGIKNFSAIINPPQACILA
- Top Product
- Discover our top product DLAT Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DLAT Blocking Peptide, catalog no. 33R-2227, is also available for use as a blocking control in assays to test for specificity of this DLAT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLAT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLAT (Dihydrolipoyl Transacetylase (DLAT))
- Alternative Name
- DLAT (DLAT Products)
- Background
- DLAT is dihydrolipoamide acetyltransferase, the E2 subunit of the mammalian pyruvate dehydrogenase complex of the inner mitochondrial membrane. Patients with primary biliary cirrhosis show autoantibodies to DLAT.
- Molecular Weight
- 69 kDa (MW of target protein)
-