DBT antibody (N-Term)

Catalog No. ABIN631072

Product Details anti-DBT Antibody

Target: DBT (Dihydrolipoamide Branched Chain Transacylase E2 (DBT))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DBT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: DBT antibody was raised against the N terminal of DBT

Purification: Affinity purified

Immunogen: DBT antibody was raised using the N terminal of DBT corresponding to a region with amino acids NYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DBT Blocking Peptide, catalog no. 33R-6946, is also available for use as a blocking control in assays to test for specificity of this DBT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DBT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DBT

Target: DBT (Dihydrolipoamide Branched Chain Transacylase E2 (DBT))

Alternative Name: DBT (DBT Products)

Synonyms: BCATE2 antibody, BCKAD-E2 antibody, BCKADE2 antibody, E2 antibody, E2B antibody, D3Wsu60e antibody, im:7147214 antibody, zgc:103768 antibody, E2b antibody, dihydrolipoamide branched chain transacylase E2 antibody, hypothetical protein antibody, dihydrolipoamide branched chain transacylase E2 L homeolog antibody, DBT antibody, dbt antibody, CpipJ_CPIJ006326 antibody, BDBG_05874 antibody, NAEGRDRAFT_78509 antibody, VDBG_04820 antibody, PGTG_17722 antibody, Dbt antibody, dbt.L antibody

Target Type: Viral Protein

Background: The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).

Molecular Weight: 46 kDa (MW of target protein)