MTRF1L antibody (N-Term)

Catalog No. ABIN631071

Product Details anti-MTRF1L Antibody

Target: MTRF1L (Mitochondrial Translational Release Factor 1-Like (MTRF1L))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTRF1L antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MTRF1 L antibody was raised against the N terminal of MTRF1

Purification: Affinity purified

Immunogen: MTRF1 L antibody was raised using the N terminal of MTRF1 corresponding to a region with amino acids ELFTRGGPLRTFLERQAGSEAHLKVRRPELLAVIKLLNEKERELRETEHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MTRF1L Blocking Peptide, catalog no. 33R-2544, is also available for use as a blocking control in assays to test for specificity of this MTRF1L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTRF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTRF1L

Target: MTRF1L (Mitochondrial Translational Release Factor 1-Like (MTRF1L))

Alternative Name: MTRF1L (MTRF1L Products)

Synonyms: fj59e12 antibody, wu:fj59e12 antibody, si:dkeyp-9b4.2 antibody, HMRF1L antibody, MRF1L antibody, mtRF1a antibody, 9130004K12Rik antibody, mitochondrial translational release factor 1 like antibody, mitochondrial translational release factor 1-like antibody, MTRF1L antibody, mtrf1l antibody, Mtrf1l antibody

Background: MTRF1L is a mitochondrial peptide chain release factor that directs the termination of translation in response to the peptide chain termination codons UAA and UAG.

Molecular Weight: 30 kDa (MW of target protein)