-
- Target See all Catenin products
- Catenin
- Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Catenin antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Catenin antibody was raised using a synthetic peptide corresponding to a region with amino acids YPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVY
-
anti-Catenin antibody
Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Catenin Blocking Peptide, catalog no. 33R-10205, is also available for use as a blocking control in assays to test for specificity of this Catenin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTNND1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Catenin
- Abstract
- Catenin Products
- Synonyms
- Bfc antibody, Catnb antibody, Mesc antibody, CTNNB antibody, MRD19 antibody, armadillo antibody, catenin (cadherin associated protein), beta 1 antibody, catenin beta 1 antibody, Ctnnb1 antibody, CTNNB1 antibody
- Background
- This gene encodes a member of the Armadillo protein family, which function in adhesion between cells and signal transduction. Multiple translation initiation codons and althernative splicing result in many different isoforms being translated.
- Molecular Weight
- 93 kDa (MW of target protein)
-
You are here:
