ACAA2 antibody (N-Term)

Catalog No. ABIN631066

Product Details anti-ACAA2 Antibody

Target: ACAA2 (Acetyl-CoA Acyltransferase 2 (ACAA2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACAA2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACAA2 antibody was raised against the N terminal of ACAA2

Purification: Affinity purified

Immunogen: ACAA2 antibody was raised using the N terminal of ACAA2 corresponding to a region with amino acids ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACAA2 Blocking Peptide, catalog no. 33R-1355, is also available for use as a blocking control in assays to test for specificity of this ACAA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACAA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACAA2

Target: ACAA2 (Acetyl-CoA Acyltransferase 2 (ACAA2))

Alternative Name: ACAA2 (ACAA2 Products)

Synonyms: DSAEC antibody, fb59b11 antibody, zgc:56036 antibody, wu:fb59b11 antibody, 0610011L04Rik antibody, AI255831 antibody, AI265397 antibody, D18Ertd240e antibody, acetyl-CoA acyltransferase 2 antibody, acetyl-Coenzyme A acyltransferase 2 (mitochondrial 3-oxoacyl-Coenzyme A thiolase) antibody, acetyl-CoA acyltransferase 2 L homeolog antibody, ACAA2 antibody, Acaa2 antibody, acaa2 antibody, acaa2.L antibody

Background: ACAA2 catalyzes the last step of the mitochondrial fatty acid beta-oxidation spiral. Unlike most mitochondrial matrix proteins, it contains a non-cleavable amino-terminal targeting signal.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process