VPS28 antibody
-
- Target See all VPS28 Antibodies
- VPS28 (Vacuolar Protein Sorting 28 (VPS28))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This VPS28 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- VPS28 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ
- Top Product
- Discover our top product VPS28 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
VPS28 Blocking Peptide, catalog no. 33R-5993, is also available for use as a blocking control in assays to test for specificity of this VPS28 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS28 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VPS28 (Vacuolar Protein Sorting 28 (VPS28))
- Alternative Name
- VPS28 (VPS28 Products)
- Synonyms
- CG12770 antibody, DmVps28 antibody, Dmel\\CG12770 antibody, Dvps28 antibody, ESCRT-I antibody, ESCRT-II antibody, dVps28 antibody, dvps28 antibody, l(2)k16503 antibody, vps28 antibody, VPS28 antibody, GB12925 antibody, VPL13 antibody, VPT28 antibody, DDBDRAFT_0186436 antibody, DDBDRAFT_0234023 antibody, DDB_0186436 antibody, DDB_0234023 antibody, 1110014J03Rik antibody, AI847241 antibody, D730005C08Rik antibody, zgc:66078 antibody, Vacuolar protein sorting 28 antibody, VPS28, ESCRT-I subunit antibody, vacuolar protein sorting 28 homolog antibody, vacuolar protein sorting-associated protein 28 homolog antibody, ESCRT-I subunit protein VPS28 antibody, ESCRT I complex subunit Vps28 antibody, transport of soluble vacuolar hydrolase precursors antibody, subunit of the ESCRT-I complex antibody, vacuolar protein sorting-associated protein antibody, vacuolar protein sorting 28 family protein antibody, vacuolar protein sorting-associated protein 28 antibody, Vacuolar protein sorting-associated protein 28 homolog antibody, vacuolar protein sorting 28 antibody, vacuolar protein sorting 28 (yeast) antibody, vacuolar protein sorting 28 homolog S homeolog antibody, Vps28 antibody, VPS28 antibody, vps28 antibody, LOC408783 antibody, CpipJ_CPIJ003920 antibody, LACBIDRAFT_399656 antibody, PTRG_04781 antibody, MCYG_00028 antibody, PITG_04534 antibody, Tsp_08691 antibody, Tsp_08687 antibody, Tsp_08688 antibody, vps-28 antibody, vps28.S antibody
- Background
- This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway.
- Molecular Weight
- 25 kDa (MW of target protein)
-