HADH antibody (C-Term)
-
- Target See all HADH Antibodies
- HADH (Hydroxyacyl-CoA Dehydrogenase (HADH))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This HADH antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- HADH antibody was raised against the C terminal of HADH
- Purification
- Affinity purified
- Immunogen
- HADH antibody was raised using the C terminal of HADH corresponding to a region with amino acids YPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFG
- Top Product
- Discover our top product HADH Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
HADH Blocking Peptide, catalog no. 33R-10203, is also available for use as a blocking control in assays to test for specificity of this HADH antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HADH antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HADH (Hydroxyacyl-CoA Dehydrogenase (HADH))
- Alternative Name
- HADH (HADH Products)
- Background
- HADH functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene.
- Molecular Weight
- 33 kDa (MW of target protein)
- Pathways
- Negative Regulation of Hormone Secretion, Monocarboxylic Acid Catabolic Process
-