ALAS2 antibody (N-Term)

Catalog No. ABIN631054

Product Details anti-ALAS2 Antibody

Target: ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALAS2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ALAS2 antibody was raised against the N terminal of ALAS2

Purification: Affinity purified

Immunogen: ALAS2 antibody was raised using the N terminal of ALAS2 corresponding to a region with amino acids CPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALAS2 Blocking Peptide, catalog no. 33R-1765, is also available for use as a blocking control in assays to test for specificity of this ALAS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALAS2

Target: ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))

Alternative Name: ALAS2 (ALAS2 Products)

Synonyms: anh1 antibody, asb antibody, xlsa antibody, ALAS-E antibody, ALASE antibody, ANH1 antibody, ASB antibody, XLDPP antibody, XLEPP antibody, XLSA antibody, alas-e antibody, cb1063 antibody, sau antibody, sauternes antibody, ALAS antibody, Alas-2 antibody, 5'-aminolevulinate synthase 2 antibody, aminolevulinate, delta-, synthase 2 antibody, aminolevulinic acid synthase 2, erythroid antibody, alas2 antibody, ALAS2 antibody, Alas2 antibody, alas2.L antibody

Background: ALAS2 specifies an erythroid-specific mitochondrially located enzyme. The protein catalyzes the first step in the heme biosynthetic pathway. Defects in its gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molecular Weight: 60 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis