LRP1 antibody
-
- Target See all LRP1 Antibodies
- LRP1 (Low Density Lipoprotein Receptor-Related Protein 1 (LRP1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This LRP1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- LRP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR
- Top Product
- Discover our top product LRP1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LRP1 Blocking Peptide, catalog no. 33R-1577, is also available for use as a blocking control in assays to test for specificity of this LRP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRP1 (Low Density Lipoprotein Receptor-Related Protein 1 (LRP1))
- Alternative Name
- LRP1 (LRP1 Products)
- Synonyms
- A2MR antibody, APOER antibody, APR antibody, CD91 antibody, IGFBP3R antibody, LRP antibody, LRP1A antibody, TGFBR5 antibody, A2mr antibody, AI316852 antibody, Lrp antibody, LRP-1 antibody, LDL receptor related protein 1 antibody, prolow-density lipoprotein receptor-related protein 1 antibody, low density lipoprotein receptor-related protein 1 antibody, LRP1 antibody, Lrp1 antibody, LOC100414789 antibody
- Background
- Low-density lipoprotein receptor-related protein 1 (-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.
- Molecular Weight
- 48 kDa (MW of target protein)
- Pathways
- Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling
-