GLYAT antibody (N-Term)

Catalog No. ABIN631040

Product Details anti-GLYAT Antibody

Target: GLYAT (Glycine N-Acyltransferase (GLYAT))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLYAT antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLYAT antibody was raised against the N terminal of GLYAT

Purification: Affinity purified

Immunogen: GLYAT antibody was raised using the N terminal of GLYAT corresponding to a region with amino acids HYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLYAT Blocking Peptide, catalog no. 33R-3880, is also available for use as a blocking control in assays to test for specificity of this GLYAT antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLYAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLYAT

Target: GLYAT (Glycine N-Acyltransferase (GLYAT))

Alternative Name: GLYAT (GLYAT Products)

Synonyms: ACGNAT antibody, CAT antibody, GAT antibody, A330009E03Rik antibody, AI195249 antibody, AI315345 antibody, glycine-N-acyltransferase antibody, GLYAT antibody, Glyat antibody

Background: The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoA's.

Molecular Weight: 34 kDa (MW of target protein)