Kallikrein 6 antibody (N-Term)
-
- Target See all Kallikrein 6 (KLK6) Antibodies
- Kallikrein 6 (KLK6)
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Kallikrein 6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KLK6 antibody was raised against the N terminal of KLK6
- Purification
- Affinity purified
- Immunogen
- KLK6 antibody was raised using the N terminal of KLK6 corresponding to a region with amino acids KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ
- Top Product
- Discover our top product KLK6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KLK6 Blocking Peptide, catalog no. 33R-4416, is also available for use as a blocking control in assays to test for specificity of this KLK6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Kallikrein 6 (KLK6)
- Alternative Name
- KLK6 (KLK6 Products)
- Synonyms
- Bssp antibody, Klk7 antibody, PRSS18 antibody, PRSS9 antibody, SP59 antibody, hK6 antibody, Prss9 antibody, AI849898 antibody, BSP antibody, Klk29 antibody, MSP antibody, Prss18 antibody, neurosin antibody, kallikrein related peptidase 6 antibody, kallikrein related-peptidase 6 antibody, kallikrein-6 antibody, KLK6 antibody, Klk6 antibody, LOC100716801 antibody
- Background
- Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene that encodes KLK6 protein is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. KLK6 is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer's disease.
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Complement System, Regulation of G-Protein Coupled Receptor Protein Signaling
-