TRMU antibody (C-Term)

Catalog No. ABIN631035

Product Details anti-TRMU Antibody

Target: TRMU (tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase (TRMU))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TRMU antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TRMU antibody was raised against the C terminal of TRMU

Purification: Affinity purified

Immunogen: TRMU antibody was raised using the C terminal of TRMU corresponding to a region with amino acids ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TRMU Blocking Peptide, catalog no. 33R-1321, is also available for use as a blocking control in assays to test for specificity of this TRMU antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRMU antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TRMU

Target: TRMU (tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase (TRMU))

Alternative Name: TRMU (TRMU Products)

Synonyms: MTO2 antibody, MTU1 antibody, TRMT antibody, TRMT1 antibody, TRNT1 antibody, 1110005N20Rik antibody, 1600025P05Rik antibody, AI314320 antibody, Trmt1 antibody, zgc:110555 antibody, tRNA 5-methylaminomethyl-2-thiouridylate methyltransferase antibody, TRMU antibody, Trmu antibody, trmu antibody

Background: TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.

Molecular Weight: 48 kDa (MW of target protein)