P5CS antibody (N-Term)

Catalog No. ABIN631032

Product Details anti-P5CS Antibody

Target: P5CS (ALDH18A1) (Aldehyde Dehydrogenase 18 Family, Member A1 (ALDH18A1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This P5CS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ALDH18 A1 antibody was raised against the N terminal of ALDH18 1

Purification: Affinity purified

Immunogen: ALDH18 A1 antibody was raised using the N terminal of ALDH18 1 corresponding to a region with amino acids SVIRHVRSWSNIPFITVPLSRTHGKSFAHRSELKHAKRIVVKLGSAVVTR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALDH18A1 Blocking Peptide, catalog no. 33R-8914, is also available for use as a blocking control in assays to test for specificity of this ALDH18A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH10 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for P5CS

Target: P5CS (ALDH18A1) (Aldehyde Dehydrogenase 18 Family, Member A1 (ALDH18A1))

Alternative Name: ALDH18A1 (ALDH18A1 Products)

Synonyms: ALDH18A1 antibody, ARCL3A antibody, GSAS antibody, P5CS antibody, PYCS antibody, 2810433K04Rik antibody, AI429789 antibody, Pycs antibody, cb842 antibody, cb899 antibody, pycs antibody, sb:cb881 antibody, wu:fa91f10 antibody, wu:fi05f11 antibody, wu:fi17d12 antibody, aldehyde dehydrogenase 18 family member A1 antibody, aldehyde dehydrogenase 18 family, member A1 antibody, aldehyde dehydrogenase 18 family member A1 L homeolog antibody, ALDH18A1 antibody, aldh18a1 antibody, Aldh18a1 antibody, aldh18a1.L antibody

Background: This gene is a member of the aldehyde dehydrogenase family and encodes a bifunctional ATP- and NADPH-dependent mitochondrial enzyme with both gamma-glutamyl kinase and gamma-glutamyl phosphate reductase activities. The encoded protein catalyzes the reduction of glutamate to delta1-pyrroline-5-carboxylate, a critical step in the de novo biosynthesis of proline, ornithine and arginine. Mutations in this gene lead to hyperammonemia, hypoornithinemia, hypocitrullinemia, hypoargininemia and hypoprolinemia and may be associated with neurodegeneration, cataracts and connective tissue diseases.

Molecular Weight: 87 kDa (MW of target protein)