ETFB antibody (C-Term)

Catalog No. ABIN631031

Product Details anti-ETFB Antibody

Target: ETFB (Electron-Transfer-Flavoprotein, beta Polypeptide (ETFB))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ETFB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ETFB antibody was raised against the C terminal of ETFB

Purification: Affinity purified

Immunogen: ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ETFB Blocking Peptide, catalog no. 33R-8967, is also available for use as a blocking control in assays to test for specificity of this ETFB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETFB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ETFB

Target: ETFB (Electron-Transfer-Flavoprotein, beta Polypeptide (ETFB))

Alternative Name: ETFB (ETFB Products)

Synonyms: MWF20.14 antibody, MWF20_14 antibody, electron transfer flavoprotein beta antibody, 0610009I16Rik antibody, 2810441H06Rik antibody, MADD antibody, electron transfer flavoprotein beta antibody, electron transfer flavoprotein subunit beta antibody, electron transferring flavoprotein, beta polypeptide antibody, electron transfer flavoprotein beta subunit L homeolog antibody, electron transfer flavoprotein beta subunit antibody, ETFBETA antibody, FixA antibody, Etfb antibody, etfb.L antibody, ETFB antibody

Background: ETFB is the electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria.

Molecular Weight: 28 kDa (MW of target protein)