ETFB antibody (C-Term)

Catalog No. ABIN631031

Product Details anti-ETFB Antibody

Target: ETFB (Electron-Transfer-Flavoprotein, beta Polypeptide (ETFB))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ETFB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ETFB antibody was raised against the C terminal of ETFB

Purification: Affinity purified

Immunogen: ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ETFB Blocking Peptide, catalog no. 33R-8967, is also available for use as a blocking control in assays to test for specificity of this ETFB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETFB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ETFB

Target: ETFB (Electron-Transfer-Flavoprotein, beta Polypeptide (ETFB))

Alternative Name: ETFB (ETFB Products)

Background: ETFB is the electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria.

Molecular Weight: 28 kDa (MW of target protein)