ATP5F1 antibody (Middle Region)
-
- Target See all ATP5F1 Antibodies
- ATP5F1 (ATP Synthase, H+ Transporting, Mitochondrial Fo Complex, Subunit B1 (ATP5F1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP5F1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ATP5 F1 antibody was raised against the middle region of ATP5 1
- Purification
- Affinity purified
- Immunogen
- ATP5 F1 antibody was raised using the middle region of ATP5 1 corresponding to a region with amino acids VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST
- Top Product
- Discover our top product ATP5F1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ATP5F1 Blocking Peptide, catalog no. 33R-9863, is also available for use as a blocking control in assays to test for specificity of this ATP5F1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP5F1 (ATP Synthase, H+ Transporting, Mitochondrial Fo Complex, Subunit B1 (ATP5F1))
- Alternative Name
- ATP5F1 (ATP5F1 Products)
- Synonyms
- PIG47 antibody, C76477 antibody, wu:fb59g11 antibody, wu:fj08b08 antibody, zgc:101887 antibody, ATP synthase, H+ transporting, mitochondrial Fo complex subunit B1 antibody, ATP synthase, H+ transporting, mitochondrial Fo complex subunit B1 S homeolog antibody, ATP synthase F(0) complex subunit B1, mitochondrial antibody, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit B1 antibody, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1 antibody, ATP5F1 antibody, atp5f1.S antibody, atp5f1 antibody, LOC479901 antibody, Atp5f1 antibody
- Background
- ATP5F1 is a subunit of mitochondrial ATP synthase. Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. ATP synthase is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, comprising the proton channel. The catalytic portion of mitochondrial ATP synthase consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and a single representative of the other 3. The proton channel seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8).
- Molecular Weight
- 25 kDa (MW of target protein)
- Pathways
- Proton Transport, Ribonucleoside Biosynthetic Process
-