DLD antibody (Middle Region)
-
- Target See all DLD Antibodies
- DLD (Dihydrolipoamide Dehydrogenase (DLD))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DLD antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- DLD antibody was raised against the middle region of DLD
- Purification
- Affinity purified
- Immunogen
- DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF
- Top Product
- Discover our top product DLD Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DLD Blocking Peptide, catalog no. 33R-1194, is also available for use as a blocking control in assays to test for specificity of this DLD antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLD antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLD (Dihydrolipoamide Dehydrogenase (DLD))
- Alternative Name
- DLD (DLD Products)
- Synonyms
- DLDD antibody, DLDH antibody, E3 antibody, GCSL antibody, LAD antibody, PHE3 antibody, AI315664 antibody, AI746344 antibody, wu:fb24b05 antibody, DLD antibody, DDBDRAFT_0183800 antibody, DDBDRAFT_0216232 antibody, DDB_0183800 antibody, DDB_0216232 antibody, sc:d0402 antibody, dihydrolipoamide dehydrogenase antibody, dihydrolipoyl dehydrogenase antibody, deltaD antibody, DLD antibody, Dld antibody, dldh antibody, AT4G16155 antibody, CND05840 antibody, bfmBC antibody, GCSL antibody, LACBIDRAFT_182385 antibody, UREG_06178 antibody, lpd antibody, TAGG_RS02070 antibody, Arnit_2606 antibody, Mesil_1945 antibody, Trad_2118 antibody, Acear_0640 antibody, Fbal_0372 antibody, Ilyop_1890 antibody, Ftrac_1733 antibody, Ocepr_1753 antibody, Intca_2017 antibody, Deima_0504 antibody, dld antibody
- Background
- DLD is the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, Cell RedoxHomeostasis
-