MTX2 antibody (N-Term)
-
- Target See all MTX2 Antibodies
- MTX2 (Metaxin 2 (MTX2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MTX2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- Metaxin 2 antibody was raised against the N terminal of MTX2
- Purification
- Affinity purified
- Immunogen
- Metaxin 2 antibody was raised using the N terminal of MTX2 corresponding to a region with amino acids YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA
- Top Product
- Discover our top product MTX2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Metaxin 2 Blocking Peptide, catalog no. 33R-10130, is also available for use as a blocking control in assays to test for specificity of this Metaxin 2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTX2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MTX2 (Metaxin 2 (MTX2))
- Alternative Name
- Metaxin 2 (MTX2 Products)
- Background
- MTX2 is highly similar to the metaxin 2 protein from mouse, which has been shown to interact with the mitochondrial membrane protein metaxin 1. Because of this similarity, it is thought that the encoded protein is peripherally associated with the cytosolic face of the outer mitochondrial membrane and be involved in the import of proteins into the mitochondrion.
- Molecular Weight
- 29 kDa (MW of target protein)
-