MTX2 antibody (N-Term)

Catalog No. ABIN631023

Product Details anti-MTX2 Antibody

Target: MTX2 (Metaxin 2 (MTX2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MTX2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Metaxin 2 antibody was raised against the N terminal of MTX2

Purification: Affinity purified

Immunogen: Metaxin 2 antibody was raised using the N terminal of MTX2 corresponding to a region with amino acids YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Metaxin 2 Blocking Peptide, catalog no. 33R-10130, is also available for use as a blocking control in assays to test for specificity of this Metaxin 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTX2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MTX2

Target: MTX2 (Metaxin 2 (MTX2))

Alternative Name: Metaxin 2 (MTX2 Products)

Synonyms: wu:fc02d09 antibody, xmtx2 antibody, 1500012G02Rik antibody, metaxin 2 antibody, metaxin 2 L homeolog antibody, mtx2 antibody, mtx2.L antibody, MTX2 antibody, Mtx2 antibody

Background: MTX2 is highly similar to the metaxin 2 protein from mouse, which has been shown to interact with the mitochondrial membrane protein metaxin 1. Because of this similarity, it is thought that the encoded protein is peripherally associated with the cytosolic face of the outer mitochondrial membrane and be involved in the import of proteins into the mitochondrion.

Molecular Weight: 29 kDa (MW of target protein)