TCL1A antibody (N-Term)
-
- Target See all TCL1A Antibodies
- TCL1A (T-Cell Leukemia/lymphoma 1A (TCL1A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TCL1A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TCL1 A antibody was raised against the N terminal of TCL1
- Purification
- Affinity purified
- Immunogen
- TCL1 A antibody was raised using the N terminal of TCL1 corresponding to a region with amino acids MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVL
- Top Product
- Discover our top product TCL1A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TCL1A Blocking Peptide, catalog no. 33R-5631, is also available for use as a blocking control in assays to test for specificity of this TCL1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TCL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TCL1A (T-Cell Leukemia/lymphoma 1A (TCL1A))
- Alternative Name
- TCL1A (TCL1A Products)
- Synonyms
- TCL1A antibody, Tcl1a antibody, TCL1 antibody, Tcl1 antibody, T-cell leukemia/lymphoma 1A antibody, T cell lymphoma breakpoint 1 antibody, TCL1A antibody, Tcl1 antibody, Tcl1a antibody
- Background
- TCL1A can enhance the phosphorylation and activation of AKT1, AKT2 and AKT3, promote nuclear translocation of AKT1, enhance cell proliferation, stabilize mitochondrial membrane potential and promote cell survival.
- Molecular Weight
- 13 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance
-