MRPL10 antibody (N-Term)

Catalog No. ABIN631016

Product Details anti-MRPL10 Antibody

Target: MRPL10 (Mitochondrial Ribosomal Protein L10 (MRPL10))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRPL10 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MRPL10 antibody was raised against the N terminal of MRPL10

Purification: Affinity purified

Immunogen: MRPL10 antibody was raised using the N terminal of MRPL10 corresponding to a region with amino acids HRRVMHFQRQKLMAVTEYIPPKPAIHPSCLPSPPSPPQEEIGLIRLLRRE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MRPL10 Blocking Peptide, catalog no. 33R-3847, is also available for use as a blocking control in assays to test for specificity of this MRPL10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRPL10

Target: MRPL10 (Mitochondrial Ribosomal Protein L10 (MRPL10))

Alternative Name: MRPL10 (MRPL10 Products)

Synonyms: CG11488 antibody, Dmel\\CG11488 antibody, L10 antibody, 0610040E02Rik antibody, C78440 antibody, MRP-L8 antibody, Rpml8 antibody, L10MT antibody, MRP-L10 antibody, MRPL8 antibody, RPML8 antibody, L10mt antibody, zgc:112529 antibody, MRPL18 antibody, mitochondrial ribosomal protein L10 antibody, mitochondrial ribosomal protein L10 S homeolog antibody, mitochondrial 54S ribosomal protein YmL10/YmL18 antibody, mitochondrial ribosomal protein subunit L15 (predicted) antibody, mRpL10 antibody, Mrpl10 antibody, MRPL10 antibody, mrpl10.S antibody, mrpl10 antibody

Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein. A pseudogene corresponding to this gene is found on chromosome 5q.

Molecular Weight: 29 kDa (MW of target protein)