NT5M antibody (N-Term)
-
- Target See all NT5M Antibodies
- NT5M (5',3'-Nucleotidase, Mitochondrial (NT5M))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NT5M antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NT5 M antibody was raised against the N terminal of NT5
- Purification
- Affinity purified
- Immunogen
- NT5 M antibody was raised using the N terminal of NT5 corresponding to a region with amino acids ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL
- Top Product
- Discover our top product NT5M Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NT5M Blocking Peptide, catalog no. 33R-1369, is also available for use as a blocking control in assays to test for specificity of this NT5M antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NT5M (5',3'-Nucleotidase, Mitochondrial (NT5M))
- Alternative Name
- NT5M (NT5M Products)
- Background
- This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.
- Molecular Weight
- 23 kDa (MW of target protein)
-