NT5M antibody (N-Term)

Catalog No. ABIN631013

Product Details anti-NT5M Antibody

Target: NT5M (5',3'-Nucleotidase, Mitochondrial (NT5M))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NT5M antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: NT5 M antibody was raised against the N terminal of NT5

Purification: Affinity purified

Immunogen: NT5 M antibody was raised using the N terminal of NT5 corresponding to a region with amino acids ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NT5M Blocking Peptide, catalog no. 33R-1369, is also available for use as a blocking control in assays to test for specificity of this NT5M antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NT5M

Target: NT5M (5',3'-Nucleotidase, Mitochondrial (NT5M))

Alternative Name: NT5M (NT5M Products)

Synonyms: NT5M antibody, dNT-2 antibody, dNT2 antibody, mdN antibody, 2010013E09Rik antibody, AI846937 antibody, 5',3'-nucleotidase, mitochondrial antibody, NT5M antibody, Nt5m antibody, nt5m antibody

Background: This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Molecular Weight: 23 kDa (MW of target protein)