TST antibody

Catalog No. ABIN631012

Product Details anti-TST Antibody

Target: TST (Thiosulfate Sulfurtransferase (Rhodanese) (TST))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TST antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogen: TST antibody was raised using a synthetic peptide corresponding to a region with amino acids GEHLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEP

Application Details

Application Notes: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TST Blocking Peptide, catalog no. 33R-3229, is also available for use as a blocking control in assays to test for specificity of this TST antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TST antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TST

Target: TST (Thiosulfate Sulfurtransferase (Rhodanese) (TST))

Alternative Name: TST (TST Products)

Synonyms: RDS antibody, cysA antibody, SCD66.01 antibody, SCD84.31 antibody, An12g01520 antibody, SPCP25A2.01c antibody, AO090010000212 antibody, Rhodanese antibody, RHODAN antibody, thiosulfate sulfurtransferase antibody, thiosulfate sulfurtransferase, involved in tRNA wobble position thiolation Tum1 (predicted) antibody, Thiosulfate sulfurtransferase antibody, thiosulfate sulfurtransferase, mitochondrial antibody, TST antibody, SCO4164 antibody, CND03690 antibody, ANI_1_218104 antibody, tum1 antibody, AOR_1_380024 antibody, Deipr_0023 antibody, Marky_1331 antibody, Tst antibody

Background: TST is a mitochondrial matrix enzyme that is encoded by the nucleus. It may play roles in cyanide detoxification, the formation of iron-sulfur proteins, and the modification of sulfur-containing enzymes. The product contains two highly conservative domains (rhodanese homology domains), suggesting these domains have a common evolutionary origin.

Molecular Weight: 33 kDa (MW of target protein)