Coilin antibody (C-Term)

Catalog No. ABIN631002

Product Details anti-Coilin Antibody

Target: Coilin (COIL)

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Coilin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Coilin antibody was raised against the C terminal of COIL

Purification: Affinity purified

Immunogen: Coilin antibody was raised using the C terminal of COIL corresponding to a region with amino acids DYSLLPLLAAAPQVGEKIAFKLLELTSSYSPDVSDYKEGRILSHNPETQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Coilin Blocking Peptide, catalog no. 33R-2247, is also available for use as a blocking control in assays to test for specificity of this Coilin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COIL antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Coilin

Target: Coilin (COIL)

Alternative Name: Coilin (COIL Products)

Synonyms: p80c antibody, coil antibody, CG8710 antibody, Coilin antibody, Dmel\\CG8710 antibody, LOC100218802 antibody, F3F19.5 antibody, F3F19_5 antibody, CLN80 antibody, p80-coilin antibody, C79982 antibody, Cln80 antibody, p80 antibody, wu:fb08h11 antibody, sph1 antibody, Coilin antibody, coilin antibody, sphere organelles protein-like protein antibody, coilin p80 antibody, coilin L homeolog antibody, p80c antibody, COIL antibody, coil antibody, AT1G13030 antibody, Coil antibody, coil.L antibody

Background: COIL is an integral component of Cajal bodies (also called coiled bodies). Cajal bodies are nuclear suborganelles of varying number and composition that are involved in the post-transcriptional modification of small nuclear and small nucleolar RNAs. The N-terminus of the coilin protein directs its self-oligomerization while the C-terminus influences the number of nuclear bodies assembled per cell. Differential methylation and phosphorylation of coilin likely influences its localization among nuclear bodies and the composition and assembly of Cajal bodies.

Molecular Weight: 63 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization