ALAS1 antibody (N-Term)
-
- Target See all ALAS1 Antibodies
- ALAS1 (Aminolevulinate, delta-, Synthase 1 (ALAS1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ALAS1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ALAS1 antibody was raised against the N terminal of ALAS1
- Purification
- Affinity purified
- Immunogen
- ALAS1 antibody was raised using the N terminal of ALAS1 corresponding to a region with amino acids ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS
- Top Product
- Discover our top product ALAS1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ALAS1 Blocking Peptide, catalog no. 33R-2769, is also available for use as a blocking control in assays to test for specificity of this ALAS1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALAS1 (Aminolevulinate, delta-, Synthase 1 (ALAS1))
- Alternative Name
- ALAS1 (ALAS1 Products)
- Background
- Delta-aminolevulinate synthase (ALAS, EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2.
- Molecular Weight
- 70 kDa (MW of target protein)
- Pathways
- Regulation of Lipid Metabolism by PPARalpha
-