ALAS1 antibody (N-Term)

Catalog No. ABIN631001

Product Details anti-ALAS1 Antibody

Target: ALAS1 (Aminolevulinate, delta-, Synthase 1 (ALAS1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ALAS1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ALAS1 antibody was raised against the N terminal of ALAS1

Purification: Affinity purified

Immunogen: ALAS1 antibody was raised using the N terminal of ALAS1 corresponding to a region with amino acids ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ALAS1 Blocking Peptide, catalog no. 33R-2769, is also available for use as a blocking control in assays to test for specificity of this ALAS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ALAS1

Target: ALAS1 (Aminolevulinate, delta-, Synthase 1 (ALAS1))

Alternative Name: ALAS1 (ALAS1 Products)

Synonyms: ALAS antibody, ALAS3 antibody, ALASH antibody, MIG4 antibody, ALAS-N antibody, Alas-1 antibody, Alas-h antibody, ALAS-H antibody, ALASN antibody, ALAS1 antibody, wu:fb58d01 antibody, wu:fi12g09 antibody, 5'-aminolevulinate synthase 1 antibody, aminolevulinic acid synthase 1 antibody, alanyl-tRNA synthetase protein antibody, aminolevulinate, delta-, synthase 1 antibody, ALAS1 antibody, Alas1 antibody, alas1 antibody, alas1.S antibody, alaS1 antibody

Background: Delta-aminolevulinate synthase (ALAS, EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2.

Molecular Weight: 70 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha