GRPEL2 antibody
-
- Target See all GRPEL2 Antibodies
- GRPEL2 (GrpE-Like 2, Mitochondrial (GRPEL2))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GRPEL2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GRPEL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL
- Top Product
- Discover our top product GRPEL2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GRPEL2 Blocking Peptide, catalog no. 33R-3717, is also available for use as a blocking control in assays to test for specificity of this GRPEL2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRPEL2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GRPEL2 (GrpE-Like 2, Mitochondrial (GRPEL2))
- Alternative Name
- GRPEL2 (GRPEL2 Products)
- Background
- GRPEL2 is an essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. GRPEL2 seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins. GRPEL2 stimulates ATPase activity of mt-HSP70. GRPEL2 may also serve to modulate the interconversion of oligomeric (inactive) and monomeric (active) forms of mt-HSP70.
- Molecular Weight
- 25 kDa (MW of target protein)
-