MRPL15 antibody (N-Term)
-
- Target See all MRPL15 Antibodies
- MRPL15 (Mitochondrial Ribosomal Protein L15 (MRPL15))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MRPL15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- MRPL15 antibody was raised against the N terminal of MRPL15
- Purification
- Affinity purified
- Immunogen
- MRPL15 antibody was raised using the N terminal of MRPL15 corresponding to a region with amino acids KPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFN
- Top Product
- Discover our top product MRPL15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MRPL15 Blocking Peptide, catalog no. 33R-4583, is also available for use as a blocking control in assays to test for specificity of this MRPL15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MRPL15 (Mitochondrial Ribosomal Protein L15 (MRPL15))
- Alternative Name
- MRPL15 (MRPL15 Products)
- Synonyms
- L15mt antibody, MRP-L15 antibody, MRP-L7 antibody, RPML7 antibody, HSPC145 antibody, Rpml7 antibody, zgc:92856 antibody, mitochondrial ribosomal protein L15 antibody, mitochondrial ribosomal protein L15 L homeolog antibody, MRPL15 antibody, Mrpl15 antibody, mrpl15 antibody, mrpl15.L antibody
- Background
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL15 belongs to the ribosomal protein L15P family. It is a 39S subunit protein that belongs to the EcoL15 ribosomal protein family.
- Molecular Weight
- 33 kDa (MW of target protein)
-